Protein Info for Psyr_3963 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: conserved hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 transmembrane" amino acids 145 to 161 (17 residues), see Phobius details PF08668: HDOD" amino acids 23 to 200 (178 residues), 142.2 bits, see alignment E=7.3e-46

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3963)

Predicted SEED Role

"Predicted signal transduction protein" in subsystem Flagellar motility

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZPC9 at UniProt or InterPro

Protein Sequence (273 amino acids)

>Psyr_3963 conserved hypothetical protein (Pseudomonas syringae pv. syringae B728a ΔmexB)
MSKMADEVQRNLIKAIDRDALFLPTLPEVALRIRLAAEDTEISISALSKVIGSDTALSAR
LIKVANSPLLRPNFEVSDVNTAIRRLGVNYTCNLAIGLVVEQMFHAKSPVIEQKMRDIWK
QSLQVAGISYTLCQRYTNLKPDQATLAGLIHLIGILPILTYAEDHYELLSDPISLNHVID
SIHPVIGERLLRSWDFPEPLACVPGQFQNFARVSKNPDYTDLVQIATVHIHRNTDHPFSL
IEMVDLPAYSQLRLARAEDVLSAQMDEAKSMLY