Protein Info for Psyr_3947 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Methyltransferase, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 PF08003: Methyltransf_9" amino acids 8 to 318 (311 residues), 499.6 bits, see alignment E=7.7e-154 TIGR00452: tRNA (mo5U34)-methyltransferase" amino acids 9 to 316 (308 residues), 456.8 bits, see alignment E=1.4e-141 PF13489: Methyltransf_23" amino acids 113 to 266 (154 residues), 50.7 bits, see alignment E=4.3e-17 PF13847: Methyltransf_31" amino acids 118 to 224 (107 residues), 29.2 bits, see alignment E=1.8e-10 PF13649: Methyltransf_25" amino acids 122 to 216 (95 residues), 29 bits, see alignment E=3.5e-10 PF08241: Methyltransf_11" amino acids 123 to 219 (97 residues), 29.4 bits, see alignment E=2.7e-10

Best Hits

Swiss-Prot: 100% identical to CMOB_PSEU2: tRNA U34 carboxymethyltransferase (cmoB) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K15257, tRNA (mo5U34)-methyltransferase [EC: 2.1.1.-] (inferred from 100% identity to psb:Psyr_3947)

Predicted SEED Role

"tRNA (5-methoxyuridine) 34 synthase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZPE5 at UniProt or InterPro

Protein Sequence (319 amino acids)

>Psyr_3947 Methyltransferase, putative (Pseudomonas syringae pv. syringae B728a ΔmexB)
MIDLAPLVRRLAGTPLADWANGLQAQLDTKMAKGHGDLQRWQSALDALPDLQPERIDLID
SFTLEAECNGETRTVLRKALLGLSPWRKGPFNVFGVHIDTEWRSDWKWSRVSPHLDLKGK
RVLDVGCGNGYYQWRMLGAGADSVIGVDPNWLFFCQFQAMQRYLPDLPAWHLPFALEDLP
ANLEGFDTVFSMGVLYHRKSPIDHLLALKDCLVKGGELVMETLVVPGDVHQVLVPEDRYA
QMRNVWFLPSVPALELWMRRAGFTDVRCVDVSHTTVDEQRSTEWMRFQSLSDYLDPTDHS
KTVEGLPAPMRAVIVGRKP