Protein Info for Psyr_3910 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: L-aspartate ABC transporter membrane protein / L-glutamate ABC transporter membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 63 to 84 (22 residues), see Phobius details amino acids 90 to 110 (21 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 193 to 212 (20 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 10 to 114 (105 residues), 82 bits, see alignment E=1.8e-27 PF00528: BPD_transp_1" amino acids 31 to 219 (189 residues), 71.4 bits, see alignment E=4.2e-24

Best Hits

KEGG orthology group: K10002, glutamate/aspartate transport system permease protein (inferred from 98% identity to pst:PSPTO_4173)

Predicted SEED Role

"Glutamate Aspartate transport system permease protein GltK (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZPI2 at UniProt or InterPro

Protein Sequence (221 amino acids)

>Psyr_3910 L-aspartate ABC transporter membrane protein / L-glutamate ABC transporter membrane protein (Pseudomonas syringae pv. syringae B728a ΔmexB)
MDFTGIVPAIPGLWNGMVMTLKLMAMGVVGGLVLGTLLALMRLSSNKLLANVAGAYVNYF
RSIPLLLVITWFYLAVPFVLRWITGEDTPIGAFASCVVAFMMFEAAYFCEIVRAGVQSIS
KGQMGAAQALGMNYSQMMRLIILPQAFRKMTPLLLQQSIILFQDTSLVYTVGLVDFLNAS
RSSGDIIGRANEFLIIAGLVYFTISFAASLLVKRLQKRFAV