Protein Info for Psyr_3843 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: diguanylate cyclase/phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 763 transmembrane" amino acids 26 to 44 (19 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 91 to 114 (24 residues), see Phobius details amino acids 126 to 145 (20 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details amino acids 193 to 215 (23 residues), see Phobius details amino acids 237 to 257 (21 residues), see Phobius details PF03707: MHYT" amino acids 73 to 127 (55 residues), 55.7 bits, see alignment 6e-19 amino acids 134 to 178 (45 residues), 45.2 bits, see alignment 1.1e-15 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 286 to 448 (163 residues), 159.7 bits, see alignment E=2.6e-51 PF00990: GGDEF" amino acids 290 to 445 (156 residues), 166.1 bits, see alignment E=8.4e-53 PF00563: EAL" amino acids 466 to 702 (237 residues), 253.4 bits, see alignment E=2.8e-79

Best Hits

Swiss-Prot: 53% identical to Y3311_PSEAE: Uncharacterized signaling protein PA3311 (PA3311) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3843)

Predicted SEED Role

"Sensory box/GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZPP9 at UniProt or InterPro

Protein Sequence (763 amino acids)

>Psyr_3843 diguanylate cyclase/phosphodiesterase (Pseudomonas syringae pv. syringae B728a ΔmexB)
MDWLGLNVFADPPADVQLLIDCSHNLFLVALAYGVACAACFATLDIADRVIQVDALKSRR
LWKALGALCLAGGVWAMHFISMLAFQAPLKIAYDLSITLISLLIVLITALVAMRALTVPE
LTLRRCLISAVVMGVGISVMHYLGMSAMRSTATQYYEPRMFALSILVAVLSSIALLTLPR
HLRQYNGMFHQMFRYAVSLLLGAGLLTMHLMGMKALRLVIPEGTELHGPATENSQQLGLT
IAAIALLIIAGSISAAMADKKLQGKEHDLQRVNALLTQLDQARVSLQQVAHYDPLTNLIN
RRGFNQIFAEKLQEHTYNNGMLAVMFLDIDHFKRINDSLGHDAGDELLKVIADRIRGATR
VQDVVARFGGDEFCILLSIPDYEEARHLAHRVMQKMKETIALAGRRMVMTTSIGIAVFPR
DGSTCDELLKHADLALYQSKDKGRNGVNFFNPALKTKASLELQLEEELRNALREGTGLQV
YYQPIVDMRTGHVAKLEALVRWNHPHHGLLVPARFIGIAEANGLIAELDNWVLRRACHDL
RTLHQEGLEQLIISVNCSALTLGRNELVEEVERALADADAAPGRLELEVTENALMGNISN
TILMLKHIRSLGVSLSIDDFGTGYSSLAYLKRLPLDTLKIDRSFIIDIPQSPQDMEIVQA
ILVMAHTLRLKVVTEGVETQAQLEFLRQFGSDYVQGYMFSRPQPLERILPLARQMNEREA
SLQWSALPPPYAHGPDIGISEASDVFAELSDSDDFASHRPVRT