Protein Info for Psyr_3803 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: MscS Mechanosensitive ion channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 transmembrane" amino acids 26 to 51 (26 residues), see Phobius details amino acids 72 to 94 (23 residues), see Phobius details amino acids 102 to 126 (25 residues), see Phobius details amino acids 146 to 164 (19 residues), see Phobius details amino acids 170 to 186 (17 residues), see Phobius details PF00924: MS_channel_2nd" amino acids 188 to 256 (69 residues), 55.9 bits, see alignment E=1.9e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3803)

Predicted SEED Role

"Small-conductance mechanosensitive channel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZPT8 at UniProt or InterPro

Protein Sequence (430 amino acids)

>Psyr_3803 MscS Mechanosensitive ion channel (Pseudomonas syringae pv. syringae B728a ΔmexB)
MDIHSLWLKTQELWDMLDQHPWVRTGLALILLLTAALVLGRVARFLVLYAVRMLGRQPSL
HWVNDFRHNKVFHRLAQMVPSLVIQFGLTLVPGLSTAGRNVIGNIAMAFTILFMTLAIGT
LLNALLDIYARTEHARTRSIKGYVQLSKMILYVFAGIIIVATLIDRSPLLLLSGLGAMSA
VILLVYKDTLLSFVASVQLTSNDMLRVGDWIEMPQVGADGDVVDITLHTVKVQNFDKTIV
SIPTWRLMSESFRNWRGMQQSGGRRIKRSLFIDASGVRFVRDDEEQQLMQIHLLTDYIGR
KQAELLAWNQAQGNVAQMSANRRRMTNIGTFRAYALAYLKSHVDINPNMTCMVRQLEPTS
QGIPLEIYCFTRTTVWVDYERIQGDIFDYLITVMPEFGLSLYQQPSGADMRVGLRGETMS
QVTADWTKER