Protein Info for Psyr_3791 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Helicase, C-terminal:DEAD/DEAH box helicase, N-terminal

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 PF00270: DEAD" amino acids 24 to 187 (164 residues), 152.9 bits, see alignment E=1.1e-48 PF04851: ResIII" amino acids 37 to 160 (124 residues), 29.1 bits, see alignment E=1.3e-10 PF00271: Helicase_C" amino acids 231 to 338 (108 residues), 100.2 bits, see alignment E=1.2e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to pst:PSPTO_1587)

Predicted SEED Role

"ATP-dependent RNA helicase SrmB" in subsystem ATP-dependent RNA helicases, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZPV0 at UniProt or InterPro

Protein Sequence (445 amino acids)

>Psyr_3791 Helicase, C-terminal:DEAD/DEAH box helicase, N-terminal (Pseudomonas syringae pv. syringae B728a ΔmexB)
MFSEFALHERLLKAVAELKFVEPTPVQAAAIPLALQGRDLRVTAQTGSGKTAAFVLPILN
RLIGPAKVRVDIRAVILLPTRELAQQTLKEVERFSQFTFVKAGLITGGEDFKVQAAMLRK
VPDILIGTPGRLLEQLNAGNLDLKHVEVLVLDEADRMLDMGFSEDVERLAGECAGREQTM
LFSATTGGAGLREMIGKVLKDPQHLQVNSVSELASGTRHQIITADHNVHKEQVLNWLLAN
ETYQKAIIFTNTKAMADRLYGRLVALEYKAFVLHGDKDQKDRKAAIDRLKQGGAKIMVAT
DVAARGLDVEGLDMVINFDMPRSGDDYVHRVGRTGRAGSDGLAISLICHGDWNLMSSVER
YLKQSFERRVIKEVKGTYGGPKKVKASGKAVGVKKKKTDAKGDKKKVAAKGPTKRKTVNR
PKSDLVSQDGMAPLKKRSTPAPAAE