Protein Info for Psyr_3763 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: GGDEF domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 42 to 62 (21 residues), see Phobius details amino acids 83 to 105 (23 residues), see Phobius details amino acids 116 to 135 (20 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details PF05230: MASE2" amino acids 14 to 102 (89 residues), 102.5 bits, see alignment E=1e-33 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 181 to 342 (162 residues), 166.6 bits, see alignment E=2e-53 PF00990: GGDEF" amino acids 186 to 340 (155 residues), 150.4 bits, see alignment E=3.8e-48

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3763)

Predicted SEED Role

"GGDEF domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZPX8 at UniProt or InterPro

Protein Sequence (358 amino acids)

>Psyr_3763 GGDEF domain protein (Pseudomonas syringae pv. syringae B728a ΔmexB)
MSTYHRRGMAFAKRIYAPRCFGVSVGFVTVAVSLYYVNTAHWAWLLALLYSLVWPHVAYQ
LARTSREPYQAEWRNLLFDSMMGGFWIGAMGFSAVPGVTVLAMMAMHNMAAAGPRLMLQG
LCMQALGVLISLAALDPVVNLHGNMAQIYACLPVLVTYPIFIGWLSHQVTLKLWEHRNIL
RKVSRTDSLTGLLNHGAWKDLLDLEYASSQNAYQECVIALIDIDHFKVINDTYGHLMGDT
VLQSISEALIENLRDSDLIGRCGGDEFCVILPDTSLLQAKEILERLRLAIDEMTYTLHCD
LKVSLSIGIAAYSPEMPDASSWLHEADKALYLAKSTGRNRVASPQDAPPELQSLGAQA