Protein Info for Psyr_3737 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: transcriptional regulator, MarR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 144 PF12802: MarR_2" amino acids 31 to 91 (61 residues), 52.5 bits, see alignment E=1.3e-17 PF01047: MarR" amino acids 33 to 91 (59 residues), 41.9 bits, see alignment E=2.2e-14 PF13463: HTH_27" amino acids 34 to 98 (65 residues), 23.2 bits, see alignment E=2e-08 PF13545: HTH_Crp_2" amino acids 36 to 85 (50 residues), 29 bits, see alignment E=2.6e-10 PF09339: HTH_IclR" amino acids 40 to 83 (44 residues), 25.5 bits, see alignment E=2.7e-09

Best Hits

Swiss-Prot: 38% identical to SLYA_ECOLU: Transcriptional regulator SlyA (slyA) from Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)

KEGG orthology group: K06075, MarR family transcriptional regulator, transcriptional regulator for hemolysin (inferred from 100% identity to psb:Psyr_3737)

Predicted SEED Role

"Transcriptional regulator SlyA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQ04 at UniProt or InterPro

Protein Sequence (144 amino acids)

>Psyr_3737 transcriptional regulator, MarR family (Pseudomonas syringae pv. syringae B728a ΔmexB)
MPMTDEHRFGMQLGHLTRGWRAELDRRLADLGLSQARWLVLLHLARFTEPPTQRELAQSV
GVEGPTLARLLDSLEKQGLVQRQAVLEDRRAKKILLSDTALPLIEKIENIANVLRIELFE
GVSEEDLRVSMRVHSQILANLERS