Protein Info for Psyr_3716 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Response regulator receiver:Transcriptional regulatory protein, C-terminal

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 PF00072: Response_reg" amino acids 10 to 119 (110 residues), 86.7 bits, see alignment E=1.2e-28 PF00486: Trans_reg_C" amino acids 157 to 232 (76 residues), 82.8 bits, see alignment E=1.5e-27

Best Hits

Swiss-Prot: 37% identical to MPRA_MYCUA: Response regulator MprA (mprA) from Mycobacterium ulcerans (strain Agy99)

KEGG orthology group: K07661, two-component system, OmpR family, response regulator RstA (inferred from 100% identity to psb:Psyr_3716)

Predicted SEED Role

"Transcriptional regulatory protein RstA" in subsystem Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQ24 at UniProt or InterPro

Protein Sequence (247 amino acids)

>Psyr_3716 Response regulator receiver:Transcriptional regulatory protein, C-terminal (Pseudomonas syringae pv. syringae B728a ΔmexB)
MAVEPHTWHVLIVEDDQRLAELTSDYLQNHGLRVSIEGDGALAAARIIAEQPDLVILDLM
LPGEDGFSICRSVRDRYDGPILMLTARTDDTDHIEGLDTGADDFVCKPVHPRVLLARIKA
LLRRSEAPQVPAAELRRLVFGPLVVDNALREAWLREQSIELTGAEFDLLWLLVANAGRTL
SREEIFTALRGVGYDGQDRSIDVRISRIRPKIGDDPIHPRLIKTVRSKGYLFVPEAAQDM
SGHVFSG