Protein Info for Psyr_3677 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Aminotransferase, class I and II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 TIGR01140: threonine-phosphate decarboxylase" amino acids 4 to 326 (323 residues), 349.6 bits, see alignment E=8.5e-109 PF00155: Aminotran_1_2" amino acids 50 to 287 (238 residues), 101.6 bits, see alignment E=2.8e-33

Best Hits

Swiss-Prot: 63% identical to COBC_PSEAE: Threonine-phosphate decarboxylase (cobC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02225, cobalamin biosynthetic protein CobC (inferred from 100% identity to psb:Psyr_3677)

Predicted SEED Role

"L-threonine 3-O-phosphate decarboxylase (EC 4.1.1.81)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 4.1.1.81)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.81

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQ63 at UniProt or InterPro

Protein Sequence (334 amino acids)

>Psyr_3677 Aminotransferase, class I and II (Pseudomonas syringae pv. syringae B728a ΔmexB)
MLEHGGRLRAAAQHYGIHLADWLDLSTGIAPWSWPIPEIPTRAWARLPETDDGLEAAACT
YYGVTRLLPVSGSQAAIQALPRVRSGGRVGVLSPCYAEHAHAWRKNGFVVREVGEQEVEY
FLDSLDVLVVVNPNNPTGLHLSAERLLEWHARLAERGGWLVVDEAFMDNTPGVSLAAETW
RTGLIVLRSFGKFFGLAGVRLGFVMAEPVLLRMLAQEIGPWSVSGPTRIIGQVCLSDQQG
QARQRERCEQARDRLVALLDQYALTPQGGCALFQWLVTPEAQTLYEFCALRGVLLRLFKG
DSPESSSLRFGLPCDEADWLRLHDVLLEYRKEYP