Protein Info for Psyr_3635 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Competence protein ComEA helix-hairpin-helix region

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 120 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF12836: HHH_3" amino acids 55 to 117 (63 residues), 74.5 bits, see alignment E=8.6e-25 TIGR00426: competence protein ComEA helix-hairpin-helix repeat region" amino acids 56 to 118 (63 residues), 81.9 bits, see alignment E=1.4e-27 PF03934: T2SSK" amino acids 58 to 107 (50 residues), 25 bits, see alignment E=3e-09

Best Hits

Swiss-Prot: 34% identical to YBAV_ECOLI: Uncharacterized protein YbaV (ybaV) from Escherichia coli (strain K12)

KEGG orthology group: K02237, competence protein ComEA (inferred from 100% identity to psb:Psyr_3635)

Predicted SEED Role

"Competence protein ComEA helix-hairpin-helix region precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQA5 at UniProt or InterPro

Protein Sequence (120 amino acids)

>Psyr_3635 Competence protein ComEA helix-hairpin-helix region (Pseudomonas syringae pv. syringae B728a ΔmexB)
MRTPIFSALIFALLTSASVVVNAAPASQPAMSEPAVSHSPMLEGTAPAMAHEQRKDRVNL
NTADAQTLQKELAGIGKNKADAIVAYREANGDFTSIDELIEVKGIGKAILERNREKLAID