Protein Info for Psyr_3628 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: translation elongation factor P (EF-P)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 PF08207: EFP_N" amino acids 4 to 60 (57 residues), 73.1 bits, see alignment E=2.2e-24 PF01132: EFP" amino acids 68 to 122 (55 residues), 43.5 bits, see alignment E=3.7e-15 PF09285: Elong-fact-P_C" amino acids 132 to 187 (56 residues), 58.5 bits, see alignment E=6.3e-20

Best Hits

Swiss-Prot: 100% identical to EFP_PSEU2: Elongation factor P (efp) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K02356, elongation factor P (inferred from 98% identity to pst:PSPTO_1765)

Predicted SEED Role

"Translation elongation factor P" in subsystem Translation elongation factors eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQB2 at UniProt or InterPro

Protein Sequence (189 amino acids)

>Psyr_3628 translation elongation factor P (EF-P) (Pseudomonas syringae pv. syringae B728a ΔmexB)
MKTGKELKPGTVIRLENDPWLVQKAEFTKSGRNSAIMKTKLKNLLTGYKTEIVYSADDKL
DDVILDRKEATLSFISGDTYTFMDTSDYTMYELNAEDIESVLPFVEEGMTDVCEAVFFED
RLVSVELPTTIVRQVDYTEGSARGDTSGKVMKPAKLKNGTELSVADFIEIGDMIEIDTRE
GGSYKGRAK