Protein Info for Psyr_3591 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: ATP-binding region, ATPase-like:Histidine kinase, HAMP region:Histidine kinase A, N-terminal

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 150 to 173 (24 residues), see Phobius details PF00672: HAMP" amino acids 170 to 224 (55 residues), 27.7 bits, see alignment 4.2e-10 PF00512: HisKA" amino acids 230 to 293 (64 residues), 49.2 bits, see alignment E=6.8e-17 PF02518: HATPase_c" amino acids 337 to 442 (106 residues), 80.3 bits, see alignment E=2.2e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3591)

Predicted SEED Role

"Putative two-component system sensor kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQE9 at UniProt or InterPro

Protein Sequence (449 amino acids)

>Psyr_3591 ATP-binding region, ATPase-like:Histidine kinase, HAMP region:Histidine kinase A, N-terminal (Pseudomonas syringae pv. syringae B728a ΔmexB)
MRSLFWRILASFWLAIALVGGLSVLMGHMLNQDAWILSRHPVLNSLPEQWTQRFEDKGAD
NAQEFLQDIKRRNRIDTQVLSDSGEPMVRGTFPPRAAALEARQREDDDQGRKLPWRRLAT
EYSSPKTGETYLFIYRVPHPELDEWHRQSLMWPLSALGIALVVLTLFSLFVTLSITRPLS
RLRGAVYDLGQTSYQQHSLGQLANRRDEFGVLAKDFNRMGARLQSLIGSQRQLLRDVSHE
LRSPLARLRIALALAERAEPAEREKLWPRLGRECDRLEALISEILALARLDAELRGPEPV
DIEALLQRLKSDTQLDGVDQNIRVEVQDNLQFKGWPDMIERALDNLLRNALRFNPSGQSI
DLQATLVGDHIRLSVRDHGPGVADEHLTQLGEPFYRAPGQTTPGHGLGLAIAKRAAERHG
GTLMLGNHPDGGFIATLDLPREPLGSSSV