Protein Info for Psyr_3561 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: succinylarginine dihydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 PF04996: AstB" amino acids 3 to 446 (444 residues), 742.8 bits, see alignment E=6.4e-228 TIGR03241: succinylarginine dihydrolase" amino acids 4 to 446 (443 residues), 810.6 bits, see alignment E=2e-248

Best Hits

Swiss-Prot: 100% identical to ASTB_PSEU2: N-succinylarginine dihydrolase (astB) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K01484, succinylarginine dihydrolase [EC: 3.5.3.23] (inferred from 100% identity to psb:Psyr_3561)

MetaCyc: 59% identical to N-succinylarginine dihydrolase (Escherichia coli K-12 substr. MG1655)
N-succinylarginine dihydrolase. [EC: 3.5.3.23]

Predicted SEED Role

"Succinylarginine dihydrolase (EC 3.5.3.23)" in subsystem Arginine and Ornithine Degradation (EC 3.5.3.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQH9 at UniProt or InterPro

Protein Sequence (448 amino acids)

>Psyr_3561 succinylarginine dihydrolase (Pseudomonas syringae pv. syringae B728a ΔmexB)
MKSCEVNFDGLVGPTHNYGGLSYGNVASQSNSQQSANPREAALQGLAKMKALMDLGFTQG
VLAPQERPDVSGLRRLGFTGSDEQVIEKAARQDMPLLVASCSASSMWVANAATVSPSADT
ADGRVHFTAANLNCKYHRSIEHPTTTRVLGAMFADAKHFAHHPALPAVAQFGDEGAANHT
RFCRDYGEAGVEFFVFGRSAFDTRYPAPQKYPARQTLEASRAVARLHGLSEAGVVYSQQN
PAVIDQGVFHNDVIAVGNGEVLFYHQDAFLNTDPMLNELRDKLGRVGGQLRAICVPRAEV
SVQDAVRSYLFNSQLLSRPDGSMLLIVPQECQANASVWAYLQRLIADDSPVAEVKVFDLK
QSMQNGGGPACLRLRVALNDTELAAVNPGVIMTAPLYETLTQWVDRHYRDRMSESDLADP
RLLSECRTALDELTQILKLGAVYPFQLN