Protein Info for Psyr_3559 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: succinylglutamate desuccinylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03242: succinylglutamate desuccinylase
  • amino acids 6 to 327 (322 residues), 373.9 bits, E=3.5e-116
• PF04952: AstE_AspA
  • amino acids 49 to 329 (281 residues), 277.8 bits, E=5.2e-87

Best Hits

Swiss-Prot: 100% identical to ASTE_PSEU2: Succinylglutamate desuccinylase (astE) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K05526, succinylglutamate desuccinylase [EC: 3.5.1.96] (inferred from 100% identity to psb:Psyr_3559)

Predicted SEED Role

"Succinylglutamate desuccinylase (EC 3.5.1.96)" in subsystem Arginine and Ornithine Degradation (EC 3.5.1.96)

MetaCyc Pathways

• L-arginine degradation II (AST pathway) (5/5 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.96

Sequence Analysis Tools

See Q4ZQI1 at UniProt or InterPro

Protein Sequence (335 amino acids)

>Psyr_3559 succinylglutamate desuccinylase (Pseudomonas syringae pv. syringae B728a ΔmexB)
MLALGKLLELTLAGREPAEKTQLTVEGVRMRWMGEGALEVRPPEARDNGTDLLLSAGIHG
NETAPIELLDELIRSIARGDLKPRARILFLFGNPDAMRRGARFVEQDVNRLFNGRHLQSG
GAEALRACELERLAASFFSLPERYRLHYDLHTAIRGSTIEQFALYPWKEGRQHSRLELAR
LRAAGMSAVLLQNKPSIVFSAYTYDQLGAEAFTLELGKARPFGQNQQVNLGPLRVCLEQL
IEGTEPERDDDLEGLQLFSVAREVIKRTDAFTFNLADDVENFSPLEKGYVLAEDAGGSRW
VVEEEGARIIFPNPRVKNGLRAGILIVPTDADSLG