Protein Info for Psyr_3516 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Protein of unknown function DUF1338

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 PF07063: HGLS" amino acids 16 to 408 (393 residues), 551.3 bits, see alignment E=7.6e-170

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3516)

MetaCyc: 70% identical to 2-oxoadipate dioxygenase/decarboxylase (Pseudomonas putida KT2440)
RXN-21282 [EC: 1.13.11.93]

Predicted SEED Role

"FIG00960493: hypothetical protein"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.93

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQM4 at UniProt or InterPro

Protein Sequence (463 amino acids)

>Psyr_3516 Protein of unknown function DUF1338 (Pseudomonas syringae pv. syringae B728a ΔmexB)
MSTARFADPDQIRAGFSRAMSQMYKHEVPLYGTLMALVSEVNEQVMSHDSSVLDSLRQTG
EIQRLDMERHGAIRVGTAQELATLARLFAVMGMQPVGYYDLSAAGVPVHSTAFRAVHEQA
LQVSPFRVFTSLLRLELIESDSLREFASQVLGKRSIFTPGALALIEKHEADGGLSEADAA
EFIQQALETFRWHNTATVSLDDYQKLNTQHRLIADVVAFRGPHINHLTPRTLDIDAVQAG
MPGKGITPKAVVEGPPRRQCPILLRQTSFKALEEPIAFIGQGGSQSGSHSARFGEIEQRG
AALTPKGRELYDRLLSEARDALGEFPNEANAVRYAGLLEETFKAFPDSHAEMRRQGLAYF
RYFPTESGIAARASGSLEQLVEAGHVRFEPLVYEDFLPVSAAGIFQSNLGDNAQAHYATN
SNQQDFERALGRGTLNELDLYADTQRRSLEECAKALELSSPAY