Protein Info for Psyr_3463 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Flagellar protein FliS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 129 PF02561: FliS" amino acids 8 to 125 (118 residues), 114.6 bits, see alignment E=1.6e-37 TIGR00208: flagellar protein FliS" amino acids 9 to 124 (116 residues), 80.4 bits, see alignment E=6.1e-27

Best Hits

Swiss-Prot: 40% identical to FLIS_VIBCH: Flagellar secretion chaperone FliS (fliS) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K02422, flagellar protein FliS (inferred from 100% identity to psb:Psyr_3463)

Predicted SEED Role

"Flagellar biosynthesis protein FliS" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQS7 at UniProt or InterPro

Protein Sequence (129 amino acids)

>Psyr_3463 Flagellar protein FliS (Pseudomonas syringae pv. syringae B728a ΔmexB)
MNPMLALRQYQKIGSQAQTSEASPHRLVQMLMEGGLDRIAQAKGAMARKDIASKGVLISK
AIDIVGGLREGLDLESSPSDALVRQDSLYHYMMTRLAEANARNDQKMLDEVAGLLITVKE
GWDAIGTLQ