Protein Info for Psyr_3446 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Surface presentation of antigens (SPOA) protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 TIGR02480: flagellar motor switch protein FliN" amino acids 69 to 144 (76 residues), 111.4 bits, see alignment E=7.6e-37 PF01052: FliMN_C" amino acids 73 to 142 (70 residues), 85.8 bits, see alignment E=8e-29

Best Hits

Swiss-Prot: 77% identical to FLIN_PSEAE: Flagellar motor switch protein FliN (fliN) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02417, flagellar motor switch protein FliN/FliY (inferred from 98% identity to pst:PSPTO_1970)

Predicted SEED Role

"Flagellar motor switch protein FliN" in subsystem Bacterial Chemotaxis or Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQU4 at UniProt or InterPro

Protein Sequence (152 amino acids)

>Psyr_3446 Surface presentation of antigens (SPOA) protein (Pseudomonas syringae pv. syringae B728a ΔmexB)
MADENDMTSAEDQALADEWAAALGEAGDSQADIDALLAADAGNSGSRMAMEEFGSVPKST
GPVSLDGPNLDVILDIPVSISMEVGSTDINIRNLLQLNQGSVIELDRLAGEPLDVLVNGT
LIAHGEVVVVNEKFGIRLTDVISPSERIKKLR