Protein Info for Psyr_3405 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Abortive infection protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 46 (18 residues), see Phobius details amino acids 53 to 72 (20 residues), see Phobius details amino acids 100 to 116 (17 residues), see Phobius details amino acids 127 to 148 (22 residues), see Phobius details amino acids 159 to 181 (23 residues), see Phobius details amino acids 193 to 212 (20 residues), see Phobius details amino acids 218 to 236 (19 residues), see Phobius details amino acids 240 to 261 (22 residues), see Phobius details PF02517: Rce1-like" amino acids 158 to 251 (94 residues), 50.8 bits, see alignment E=8.2e-18

Best Hits

KEGG orthology group: K07052, (no description) (inferred from 100% identity to psb:Psyr_3405)

Predicted SEED Role

"CAAX amino terminal protease family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZQY5 at UniProt or InterPro

Protein Sequence (265 amino acids)

>Psyr_3405 Abortive infection protein (Pseudomonas syringae pv. syringae B728a ΔmexB)
MTTRHWLTFCLLSSGYALALFHGNLDPSAALSFGALFIAWSCVARSSYSSIRLCGHGLFI
VTGLALAFHLAPGFNNANVIEATRFSADAALFSMDLSLDKPLIGFWLIVACPWILPKVDV
AHSLQTGVLALIVTSAFCMTAAVMLNVVGWTPKWPAQGLIWLLNNLLLVTLTEELFFRAY
LQGGLLRLFKGSRYATALSITLAAGLFGLAHAGAGPQWVALAGMAGVGYGLAFRFGGLQA
AVISHLGLNLVHFGLFTYPMLARQG