Protein Info for Psyr_3325 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: fumarylacetoacetate hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 TIGR01266: fumarylacetoacetase" amino acids 9 to 430 (422 residues), 598.9 bits, see alignment E=2.5e-184 PF09298: FAA_hydrolase_N" amino acids 23 to 125 (103 residues), 88.1 bits, see alignment E=4.1e-29 PF01557: FAA_hydrolase" amino acids 159 to 429 (271 residues), 126.7 bits, see alignment E=1.1e-40

Best Hits

KEGG orthology group: K01555, fumarylacetoacetase [EC: 3.7.1.2] (inferred from 100% identity to psb:Psyr_3325)

Predicted SEED Role

"Fumarylacetoacetase (EC 3.7.1.2)" in subsystem Homogentisate pathway of aromatic compound degradation or Salicylate and gentisate catabolism (EC 3.7.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZR65 at UniProt or InterPro

Protein Sequence (431 amino acids)

>Psyr_3325 fumarylacetoacetate hydrolase (Pseudomonas syringae pv. syringae B728a ΔmexB)
MTTALNRRSWVESANGHADFPLQNLPLGVFSHGQTCPRGGVAIGDRIFDLRAATEAGVFQ
APAAEVAEVASRDQLNDFLALGAAARQALRAALLQLLDEDSPQRDRLQGVAGLLLPMSEC
TLHMPARVGDYSDFYVGIHHALNVGKLFRPDNPLLPNYKYVPIGYHGRASTLCPSGTAVR
RPSGQTLAAGQNAPAFGPCQRLDYELELGVWIGPGNAQGESIGIDRAAEHIAGFCLLNDW
SARDIQAWEYQPLGPFLSKSFATTISPWVVTAEALEPFRRAQPPRPDGDPQPLSYLLDDH
DQQGGALDIELEVLLRTAQMKADGLAPHRLGLSNSLNMYWTVAQMVAHHSVNGCKLQPGD
LLGTGTLSGPQEGQYGSLLEMTAGGKQPVTLPNGEVRMFLQSGDEVILRARCHREGHVSI
GFGECRGVVLD