Protein Info for Psyr_3313 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: C4-dicarboxylate transporter/malic acid transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 transmembrane" amino acids 31 to 49 (19 residues), see Phobius details amino acids 61 to 84 (24 residues), see Phobius details amino acids 97 to 121 (25 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details amino acids 166 to 190 (25 residues), see Phobius details amino acids 203 to 226 (24 residues), see Phobius details amino acids 237 to 256 (20 residues), see Phobius details amino acids 273 to 301 (29 residues), see Phobius details amino acids 311 to 330 (20 residues), see Phobius details amino acids 338 to 360 (23 residues), see Phobius details PF03595: SLAC1" amino acids 26 to 364 (339 residues), 309.4 bits, see alignment E=1.5e-96

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3313)

Predicted SEED Role

"C4-dicarboxylate transporter/malic acid transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZR77 at UniProt or InterPro

Protein Sequence (386 amino acids)

>Psyr_3313 C4-dicarboxylate transporter/malic acid transport protein (Pseudomonas syringae pv. syringae B728a ΔmexB)
MSRLAILIKGNAPLAALTSPLEAIRQFTPNWFAVTMGTGILSLALAQLPGGPAPLRAVGE
ALWFLNIALFTLFSVMYASRWLLFFDEARQVFGHSTVSMFFGTIPMGLATIINGLLVFGP
ARWGSTIVPVAEALWWLDVAMAMACGVLIPFMMFTRQEHSIEKMTAVWLLPVVAAEVAAA
CGGSLTTHLAAADSQFTVLITSYVLWAYSVPVALSILVILLLRLALHKLPHESMAASSWL
ALGPIGTGALGMLVMGSDAPAIFAAHGLASIGTVAAGIGVVVGMLFWGLGLWWMALAVLI
TLRYVKQGIGFNLGWWAFTFPLGVYALATLKLGATLHLGFFDVFGTWLVALLALMWSVVS
VRTLAGAYRGYLFVSPCIAAQGGVRR