Protein Info for Psyr_3267 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: AP endonuclease, family 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01261: AP_endonuc_2
  • amino acids 19 to 277 (259 residues), 180.8 bits, E=2e-57

Best Hits

Swiss-Prot: 66% identical to IOLH_BACSU: Protein IolH (iolH) from Bacillus subtilis (strain 168)

KEGG orthology group: K06605, myo-inositol catabolism protein IolH (inferred from 100% identity to psb:Psyr_3267)

Predicted SEED Role

"Glyceraldehyde-3-phosphate ketol-isomerase (EC 5.3.1.1)" in subsystem Inositol catabolism (EC 5.3.1.1)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (23/26 steps found)
• gluconeogenesis I (13/13 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (11/12 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (14/17 steps found)
• glycolysis II (from fructose 6-phosphate) (9/11 steps found)
• glycolysis III (from glucose) (9/11 steps found)
• Calvin-Benson-Bassham cycle (10/13 steps found)
• glycolysis I (from glucose 6-phosphate) (10/13 steps found)
• gluconeogenesis III (9/12 steps found)
• homolactic fermentation (9/12 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
• ethene biosynthesis V (engineered) (18/25 steps found)
• glycolysis IV (7/10 steps found)
• glycolysis V (Pyrococcus) (7/10 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• glycerol degradation to butanol (11/16 steps found)
• sucrose degradation V (sucrose α-glucosidase) (3/5 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (13/19 steps found)
• glycolysis VI (from fructose) (7/11 steps found)
• superpathway of hexitol degradation (bacteria) (12/18 steps found)
• oxygenic photosynthesis (11/17 steps found)
• superpathway of N-acetylneuraminate degradation (12/22 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (9/18 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)

KEGG Metabolic Maps

• Carbon fixation in photosynthetic organisms
• Fructose and mannose metabolism
• Glycolysis / Gluconeogenesis
• Inositol phosphate metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.1

Use Curated BLAST to search for 5.3.1.1

Sequence Analysis Tools

See Q4ZRC3 at UniProt or InterPro

Protein Sequence (286 amino acids)

>Psyr_3267 AP endonuclease, family 2 (Pseudomonas syringae pv. syringae B728a ΔmexB)
MRIALDPYMYRHLSLGAMVDKTAELGYDYIELSPREDFMPFYKYPRVDRARIREFRKALS
DAGVKLSSLLPLYHWAAPDEDLRIAAVRNWKRAIQVAVEMDCDLMNTEFSGQSDHALVCE
NQFMKSMDELMPHFEREGIKLDIQAHPYDFCERNNESVDIIRGLDRDWINYLYAAPHTFF
YDDGVGDIASMLRYAGDKLTHLIIADTYNHRASSNLRYIVNPPGVTATVHQHLDIGQGEV
NWEAFFSTLRDINFDGIATVAVFAWEERADESSRFMLERVKSELFR