Protein Info for Psyr_3251 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Protein of unknown function DUF6

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 transmembrane" amino acids 14 to 35 (22 residues), see Phobius details amino acids 41 to 61 (21 residues), see Phobius details amino acids 71 to 92 (22 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 125 to 144 (20 residues), see Phobius details amino acids 156 to 177 (22 residues), see Phobius details amino acids 184 to 204 (21 residues), see Phobius details amino acids 210 to 232 (23 residues), see Phobius details amino acids 244 to 262 (19 residues), see Phobius details amino acids 268 to 286 (19 residues), see Phobius details PF00892: EamA" amino acids 15 to 141 (127 residues), 54.5 bits, see alignment E=7.6e-19 amino acids 153 to 283 (131 residues), 46.8 bits, see alignment E=1.9e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3251)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZRD9 at UniProt or InterPro

Protein Sequence (311 amino acids)

>Psyr_3251 Protein of unknown function DUF6 (Pseudomonas syringae pv. syringae B728a ΔmexB)
MKSISRIPRISKAEAVLILITMLWGGTFLLVQHAMTVSGPMFFVGLRFAAAALIVALFSM
QVLRGLTFLELKAGVFIGTAIMLGYGLQTIGLQTIPSSQSAFITALYVPCVPLLQWLVLG
RRPGLMPTLGIILAFTGLMLVAGPQGASLQLSSGEIVTLISTVAIAAEIIMISAYAGEVD
VRRVTVVQLATASALAFLMIVPTQEHLPEFSWLLVLSAVGLGTMSAAIQIAMNWAQKSVS
PTRATVIYAGEPVWAGIVGRLAGERLPGIALLGAALIVAGVIVSEIKRRSAPDEHNIVDE
EEGQQGARKAE