Protein Info for Psyr_3205 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: NADH dehydrogenase subunit J

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 169 transmembrane" amino acids 6 to 21 (16 residues), see Phobius details amino acids 28 to 50 (23 residues), see Phobius details amino acids 56 to 78 (23 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 135 to 159 (25 residues), see Phobius details PF00499: Oxidored_q3" amino acids 15 to 159 (145 residues), 126.2 bits, see alignment E=4.2e-41

Best Hits

Swiss-Prot: 78% identical to NUOJ_PSEAE: NADH-quinone oxidoreductase subunit J (nuoJ) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00339, NADH dehydrogenase I subunit J [EC: 1.6.5.3] (inferred from 100% identity to psb:Psyr_3205)

MetaCyc: 89% identical to NADH-quinone oxidoreductase subunit J (Pseudomonas putida KT2440)
NADH-DEHYDROG-A-RXN [EC: 7.1.1.2]

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain J (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3 or 7.1.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZRI5 at UniProt or InterPro

Protein Sequence (169 amino acids)

>Psyr_3205 NADH dehydrogenase subunit J (Pseudomonas syringae pv. syringae B728a ΔmexB)
MEFAFYFASGIAVVSTLRVITNTNPVHALLYLIISLIAVAMTFFSLGAPFAGVLEVIAYA
GAIMVLFVFVVMMLNLGPASVQQERAWLKPGIWIGPVILGALLLAELLYVLFANPTGAGV
GHTTVDAKAVGISLFGPYLLVVELASMLLLAAAITAFHLGRNEAKEPSQ