Protein Info for Psyr_3159 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Type I secretion outer membrane protein, TolC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR01844: type I secretion outer membrane protein, TolC family" amino acids 29 to 445 (417 residues), 376.4 bits, see alignment E=9.2e-117 PF02321: OEP" amino acids 29 to 219 (191 residues), 71.5 bits, see alignment E=4e-24 amino acids 246 to 431 (186 residues), 106.1 bits, see alignment E=9.8e-35

Best Hits

Swiss-Prot: 52% identical to APRF_PSEAE: Alkaline protease secretion protein AprF (aprF) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K12538, outer membrane protein HasF (inferred from 100% identity to psb:Psyr_3159)

Predicted SEED Role

"Type I secretion outer membrane protein, TolC precursor" in subsystem Multidrug Resistance Efflux Pumps or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZRN1 at UniProt or InterPro

Protein Sequence (449 amino acids)

>Psyr_3159 Type I secretion outer membrane protein, TolC (Pseudomonas syringae pv. syringae B728a ΔmexB)
MSRHPFKAALLTAILLGTAPLSQAMGPFQVYELALRNDPVYLGALKERDAGLENRVIGRA
GLLPRVSYSYNKGRNDSKATLKGSAQDTTDHRHYNSFGSSLTVQQPLIDYEAYANYRKGL
AQALFADETFRSKSQELLVRVLTLYTQALFAQDQINIARAKQQAFERQFAQNRQMFERGE
GTRTDILEAESRNELAIAEQIEASDEQDAALRELAALLGEPSIDVAQLEPLRDSFQALVL
APSSFTEWHALAMANSPILASQRQSLEVARYEVERNRAGHLPTVNAYASIRQNESDSGNT
YNQRYDTNTIGIELSLPLYAGGGTSASVRQANSKREQAEYELEGKTRETLIELRRQFNAC
ASGVNKLRAYQKALISAQALVESTRQSILGGERISLDALNAEQQLYSTRRDLAKARYDYL
MAWIKLHYYAGTLRDTDLARIDEAFVVAR