Protein Info for Psyr_3098 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: GCN5-related N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 PF00583: Acetyltransf_1" amino acids 44 to 144 (101 residues), 66.9 bits, see alignment E=4.8e-22 PF13527: Acetyltransf_9" amino acids 51 to 128 (78 residues), 25.5 bits, see alignment E=3e-09 PF13508: Acetyltransf_7" amino acids 52 to 145 (94 residues), 47.8 bits, see alignment E=3.8e-16 PF13673: Acetyltransf_10" amino acids 81 to 150 (70 residues), 32.7 bits, see alignment E=1.6e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3098)

Predicted SEED Role

"Histone acetyltransferase HPA2 and related acetyltransferases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZRU2 at UniProt or InterPro

Protein Sequence (164 amino acids)

>Psyr_3098 GCN5-related N-acetyltransferase (Pseudomonas syringae pv. syringae B728a ΔmexB)
MNITITEVHPAEIPHTVDFVMRARAGIFPLLDSVTVPPDLAGFEQVYLNGEDGKFLIARC
EGQIIAAVGYLPYDHRFPQFDYRGRRTVEIVRLFVTPEFRGDGLASRLCQALWEYAEAGG
IEVLYLHTHPFLPGAIRFWEKQGFAVTDVESDPVWNTTHMERAL