Protein Info for Psyr_3092 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: PAP2 superfamily protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 73 to 91 (19 residues), see Phobius details amino acids 120 to 139 (20 residues), see Phobius details amino acids 179 to 197 (19 residues), see Phobius details amino acids 207 to 228 (22 residues), see Phobius details amino acids 234 to 253 (20 residues), see Phobius details PF01569: PAP2" amino acids 124 to 255 (132 residues), 38.7 bits, see alignment E=4.1e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3092)

Predicted SEED Role

"PAP2 superfamily protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZRU8 at UniProt or InterPro

Protein Sequence (290 amino acids)

>Psyr_3092 PAP2 superfamily protein (Pseudomonas syringae pv. syringae B728a ΔmexB)
MTTSSSARLRFYGINLGVPVFFALLVFVTFDLTTIDRQLTDLFFDSTAGVFPVGQSHLFE
NITHRWARILPNWTGELAIIGAMLSFVWPLLEKYDDSRLARRLTGSRLGTFLRFARRHRL
DFFFVIVAFALSTAMIHYLKSHTSVYCPVETTLYGGSQAHIEWFRNFNLLHEAGAGRCWP
GGHASSAFSLLALYFVARRYCWRHSNILLAGILLLGMIYGTTRVLQGWHFMSHTFWAGIV
VWLSTLLVALCFYGRSRLQQPIHQAVAVNRPDAFVTQPADSLVTGSRSAG