Protein Info for Psyr_3057 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: transcriptional regulator, DeoR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 PF08279: HTH_11" amino acids 32 to 73 (42 residues), 32 bits, see alignment 1.4e-11 PF08220: HTH_DeoR" amino acids 32 to 87 (56 residues), 60.2 bits, see alignment E=2e-20 PF00455: DeoRC" amino acids 102 to 257 (156 residues), 149.9 bits, see alignment E=9.3e-48

Best Hits

Swiss-Prot: 32% identical to GLPR_ECOLI: Glycerol-3-phosphate regulon repressor (glpR) from Escherichia coli (strain K12)

KEGG orthology group: K02444, DeoR family transcriptional regulator, glycerol-3-phosphate regulon repressor (inferred from 100% identity to psb:Psyr_3057)

Predicted SEED Role

"Glycerol-3-phosphate regulon repressor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZRY1 at UniProt or InterPro

Protein Sequence (278 amino acids)

>Psyr_3057 transcriptional regulator, DeoR family (Pseudomonas syringae pv. syringae B728a ΔmexB)
MSLLHADQRPKGPDTGVITLQRNVTPMLNQPRLDEIMRLLAQQQRVKASDLAQLLFVSEE
TIRRDFKHLEEEGRLRRIHGGAILPRSSEELPLQERSRLKPRAKACIAVRAAQLVSEGMA
IFLDTGTSTLALAQQLTRFSQLKIITNSLDIAQLISHQSDNQVLVAPGDVRRTDNALIGP
HTLEFARQFHYDIAFMGIGGIDLDFGLMDYQEPEAMLRRTLVRHCTRSVVLADDGKFGHR
TFINTLPFAAITTLVTNRALSDEFATRLEKDHVDTLYS