Protein Info for Psyr_3018 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: membrane protein, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 79 to 98 (20 residues), see Phobius details amino acids 108 to 127 (20 residues), see Phobius details amino acids 144 to 162 (19 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details amino acids 202 to 225 (24 residues), see Phobius details TIGR02458: cobalt transporter subunit CbtA (proposed)" amino acids 1 to 227 (227 residues), 272.9 bits, see alignment E=1.1e-85 PF09490: CbtA" amino acids 2 to 225 (224 residues), 183.9 bits, see alignment E=2.4e-58

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3018)

Predicted SEED Role

"Predicted cobalt transporter CbtA" in subsystem Coenzyme B12 biosynthesis or Transport of Nickel and Cobalt

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZS20 at UniProt or InterPro

Protein Sequence (240 amino acids)

>Psyr_3018 membrane protein, putative (Pseudomonas syringae pv. syringae B728a ΔmexB)
MFKRIAYTAGFTGLLAALLLTLLQSLWVVPLIQQAETYENAPAEQLHQHADGAVAEHSHT
HDEAAWEPENGWQRVLSTTGGNLVVAVGFALMLAGLYTLRAPGRTVQGAWWGLAGFAVFV
LAPTLGLPPELPGTAAAELSQRQLWWLGAAASTAAGLALLVFGQNWLLKALGVAILLVPH
VLGAPQPLVHESLAPEALESQFMMASLLTNALFWVALGLISAWLFRRNDVHNDNVDLHQA