Protein Info for Psyr_3013 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: magnesium chelatase subunit ChlD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 PF13519: VWA_2" amino acids 39 to 145 (107 residues), 41.4 bits, see alignment E=1.9e-14 PF00092: VWA" amino acids 40 to 148 (109 residues), 25.5 bits, see alignment E=1.4e-09

Best Hits

KEGG orthology group: K13580, magnesium chelatase subunit ChlD-like protein (inferred from 100% identity to psb:Psyr_3013)

Predicted SEED Role

"ChlD component of cobalt chelatase involved in B12 biosynthesis" in subsystem Coenzyme B12 biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZS25 at UniProt or InterPro

Protein Sequence (195 amino acids)

>Psyr_3013 magnesium chelatase subunit ChlD (Pseudomonas syringae pv. syringae B728a ΔmexB)
MRVGADGPVQWLPTFLRGQPKSHKDLVRQPRSSRPSELLLVIVDASASTRRHQALSQAKG
LLSQMFDDAYRRRARLALLTASGTAPRWQHQGLKASSALTPWLDALGAGGGTPLPEALQQ
AAEWLGQRQKRYPAEQQRVLVLTDGRIKSLPALPAFDCASLLIDIEKGPIRLGRARELAS
SLGAEYRHIDELKRV