Protein Info for Psyr_3010 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: nicotinamide-nucleotide adenylyltransferase, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 PF13521: AAA_28" amino acids 5 to 160 (156 residues), 112.3 bits, see alignment E=1.5e-36

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3010)

Predicted SEED Role

"Ribosylnicotinamide kinase (EC 2.7.1.22)" in subsystem NAD and NADP cofactor biosynthesis global or PnuC-like transporters (EC 2.7.1.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZS28 at UniProt or InterPro

Protein Sequence (181 amino acids)

>Psyr_3010 nicotinamide-nucleotide adenylyltransferase, putative (Pseudomonas syringae pv. syringae B728a ΔmexB)
MKVLVLTGPESSGKSWLSAQIQHRFGGLLVGEYVRQFIDQQGRDTDYADIPAIARGQLAW
EDAARSAEPNLLILDTHLLSNMLWSRTLFGDCPAWIEQQLLSRSYDLHLLLSPEGVDWIS
DGQRCQPQLGERQAFFDASREWLEHHLQAYRVLGGNWEQRREQALTAVSQLLGDSADLVL
V