Protein Info for Psyr_3009 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Nicotinamide mononucleotide transporter PnuC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details transmembrane" amino acids 25 to 43 (19 residues), see Phobius details amino acids 51 to 65 (15 residues), see Phobius details amino acids 87 to 108 (22 residues), see Phobius details amino acids 114 to 132 (19 residues), see Phobius details amino acids 139 to 156 (18 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details PF04973: NMN_transporter" amino acids 3 to 181 (179 residues), 191.1 bits, see alignment E=8.2e-61 TIGR01528: nicotinamide mononucleotide transporter PnuC" amino acids 4 to 182 (179 residues), 96.1 bits, see alignment E=1.3e-31

Best Hits

KEGG orthology group: K03811, nicotinamide mononucleotide transporter (inferred from 100% identity to psb:Psyr_3009)

Predicted SEED Role

"Ribosyl nicotinamide transporter, PnuC-like" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation or PnuC-like transporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZS29 at UniProt or InterPro

Protein Sequence (187 amino acids)

>Psyr_3009 Nicotinamide mononucleotide transporter PnuC (Pseudomonas syringae pv. syringae B728a ΔmexB)
MSGLELFAAAIGVIAVWLTVKQNPWCWPIGLVMVVIYIWIFFDVKLYSDMLLQVIYAGLQ
VYGWLQWTRHGDGLPVKAVTTLQNSSVLKGLAVGALISVALGAGMAHFTDAAQPWLDAAL
TGFSLVAQVWMAQKRVQCWPLWILLDVIFVGLFIYKELYLTAALYGLFTLLAVQGWREWR
NDLALAR