Protein Info for Psyr_3007 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Protein of unknown function DUF1294

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 144 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 49 to 66 (18 residues), see Phobius details amino acids 115 to 134 (20 residues), see Phobius details PF06961: DUF1294" amino acids 59 to 113 (55 residues), 80.3 bits, see alignment E=5e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_3007)

Predicted SEED Role

"Cold-shock DNA-binding domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZS31 at UniProt or InterPro

Protein Sequence (144 amino acids)

>Psyr_3007 Protein of unknown function DUF1294 (Pseudomonas syringae pv. syringae B728a ΔmexB)
MTASRESSRPASRGRSPVRQLRLKVLALLLLCALPVYGTASLWLRQVTPIPALVLIVMSL
LAFVLYRHDKRQAGNAGQRTPENVLHGVELLGGWPGALLAQQVFRHKTRKVSFQVVFWLI
VLLHQALWIDWLFLGKRLVQLLPL