Protein Info for Psyr_2991 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: GCN5-related N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 PF13673: Acetyltransf_10" amino acids 45 to 147 (103 residues), 30.9 bits, see alignment E=3.5e-11 PF00583: Acetyltransf_1" amino acids 49 to 144 (96 residues), 66.1 bits, see alignment E=5.1e-22 PF13508: Acetyltransf_7" amino acids 63 to 144 (82 residues), 40.3 bits, see alignment E=5e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2991)

Predicted SEED Role

"Histone acetyltransferase HPA2 and related acetyltransferases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZS47 at UniProt or InterPro

Protein Sequence (163 amino acids)

>Psyr_2991 GCN5-related N-acetyltransferase (Pseudomonas syringae pv. syringae B728a ΔmexB)
MEAPEVLVLQASYTNPVHADAIGFVLNEYSMDAMGAGRPLSNDTRQQLAIELAKRPYAFS
VLAFISGEPVGLVNCFEGFSTFACRPLVNIHDVAVLSQYRGLGISQKMLLKVEEIARQRG
CCKLTLEVLEGNEVAQGAYRKLGFDNYQLSPETGRAMFWQKAL