Protein Info for Psyr_2967 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Secretion protein HlyD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 38 to 367 (330 residues), 260.9 bits, see alignment E=7e-82 PF16576: HlyD_D23" amino acids 62 to 287 (226 residues), 56.9 bits, see alignment E=2.8e-19 PF13533: Biotin_lipoyl_2" amino acids 62 to 111 (50 residues), 47.8 bits, see alignment 1.4e-16

Best Hits

Swiss-Prot: 33% identical to BEPF_BRUSU: Efflux pump periplasmic linker BepF (bepF) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2967)

MetaCyc: 30% identical to multidrug efflux pump membrane fusion lipoprotein AcrE (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-352; TRANS-RXN-354; TRANS-RXN-355; TRANS-RXN-367

Predicted SEED Role

"Multidrug efflux membrane fusion protein MexE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZS71 at UniProt or InterPro

Protein Sequence (413 amino acids)

>Psyr_2967 Secretion protein HlyD (Pseudomonas syringae pv. syringae B728a ΔmexB)
MHQTISHLRYPLTALALIVISACGRAPEATSAPGAAKVSVAKVLEQPVNEWDEFTGRLEA
PETVEVRPRVSGQIDQVAFTDGALVKKGDLLFQIDPRPFQSEVRRLEAQLQQARAVASRS
DSEAQRGERLRSNNAISAELAESRTTSAQEAKAGVAAIQAQLDLARLNLSFTRVTAPISG
RVSRAEITAGNIVTADVTALTSVVSTDKVYAYFDADERVFLKYTELARKGQRGQTTPVYL
GLSNEPGNPHLGQMNFVDNQVNPRTGTIRGRAVFDNADGAFTPGLYARLKLVGSGTYSAV
LINDEAVGTDLGKKFVLVMDKDNKPAYRAVELGPKIEGLRIVRNGLAKDDTIVVKGLQRV
RPGQPVDPEVTPMASADTLAALLKQRQALEASNLPQVAPKAAVKIASAAAPRG