Protein Info for Psyr_2897 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: regulatory protein, LuxR:Response regulator receiver

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 PF00072: Response_reg" amino acids 12 to 124 (113 residues), 95.2 bits, see alignment E=2.9e-31 PF00196: GerE" amino acids 157 to 212 (56 residues), 49.3 bits, see alignment E=2.9e-17

Best Hits

Swiss-Prot: 100% identical to GACA_PSEU2: Response regulator GacA (gacA) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2897)

Predicted SEED Role

"BarA-associated response regulator UvrY (= GacA = SirA)" in subsystem Pseudomonas quinolone signal PQS or Quorum sensing regulation in Pseudomonas or Type III secretion system orphans

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q52376 at UniProt or InterPro

Protein Sequence (222 amino acids)

>Psyr_2897 regulatory protein, LuxR:Response regulator receiver (Pseudomonas syringae pv. syringae B728a ΔmexB)
MTVARGVCLIKVLVVDDHDLVRTGITRMLADIDGLQVVGQADSGEESLKKARELKPDVVL
MDVKMPGIGGLEATRKMLRSHPDIKVVAVTVCEEDPFPTRLLQAGAAGYMTKGAGLAEMV
QAIRLVFAGQRYISPQIAQQLALKSFQPQVNNSPFDLLSEREIQIALMIVGCQKVQTISD
KLCLSPKTVNTYRYRIFEKLSISSDVELALLAVRHGMVDASA