Protein Info for Psyr_2882 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: transcriptional regulator, AraC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 PF00532: Peripla_BP_1" amino acids 50 to 270 (221 residues), 23 bits, see alignment E=1.3e-08 PF13407: Peripla_BP_4" amino acids 97 to 259 (163 residues), 35.4 bits, see alignment E=2.2e-12 PF13377: Peripla_BP_3" amino acids 115 to 279 (165 residues), 122.4 bits, see alignment E=5.5e-39 PF12833: HTH_18" amino acids 310 to 388 (79 residues), 70 bits, see alignment E=4.2e-23 PF00165: HTH_AraC" amino acids 350 to 388 (39 residues), 45.6 bits, see alignment 1.4e-15

Best Hits

Swiss-Prot: 48% identical to XYLR_ECOL6: Xylose operon regulatory protein (xylR) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 100% identity to psb:Psyr_2882)

Predicted SEED Role

"Xylose activator XylR (AraC family)" in subsystem Xylose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZSF6 at UniProt or InterPro

Protein Sequence (399 amino acids)

>Psyr_2882 transcriptional regulator, AraC family (Pseudomonas syringae pv. syringae B728a ΔmexB)
MKTVPPVHRIALLFNGSKIYDRGIISGIGNYLSSTRVSWDLFLEEDFLCRLKGIERWQGD
GIIADFDDPLIGEALAGIKLPVVAVGGSYQDERAYPKGIPYVATDNHALIKAAYEHLIEA
GLTRFACFSLPEAQANRWAQEREQAFRRLLQRDGLHAEIYRGLGTSAPLWDSAVEQQIAW
LQSLPKPIGIIAVTDARARQLLQACLTAGIAVPEQVALIGIDNDPLTRTLTRVPLSSVVQ
GTDTMGRTAARLLHQMLHGMPSSGTHILIPPDTVNVQASSLHQPLGDPYVMQALLFIRQY
ACQGIKTAQVAAYVGVSRSSLESHFRRVRGCSVHDEILRFKLAAAANGLENTGLAIAEIA
RDCGFRSAQYLHTVFRREFGCTPREYQQGANAAVQCSSA