Protein Info for Psyr_2807 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: NinB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 132 PF05772: NinB" amino acids 21 to 123 (103 residues), 120.8 bits, see alignment E=1.7e-39

Best Hits

Swiss-Prot: 45% identical to NINB_BPP21: Protein ninB (ninB) from Enterobacteria phage P21

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2807)

Predicted SEED Role

"Phage NinB DNA recombination"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZSM6 at UniProt or InterPro

Protein Sequence (132 amino acids)

>Psyr_2807 NinB (Pseudomonas syringae pv. syringae B728a ΔmexB)
MTEFAIRSTRDLNRLYGALHAIDLTKPKVVVIKDEKRPDVLNRKMWAMLRDVSEQVEWYG
KKLTDEDWKCLFSASVEKQRAEPGLDGGFVVMATSTRKQSAKWFSDLFEVIHAFGAERGV
RWTEPDRWGGRY