Protein Info for Psyr_2679 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Binding-protein-dependent transport systems inner membrane component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 101 to 122 (22 residues), see Phobius details amino acids 134 to 157 (24 residues), see Phobius details amino acids 178 to 197 (20 residues), see Phobius details amino acids 235 to 256 (22 residues), see Phobius details amino acids 280 to 304 (25 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 1 to 102 (102 residues), 53.5 bits, see alignment E=2.6e-18 PF00528: BPD_transp_1" amino acids 113 to 312 (200 residues), 144.8 bits, see alignment E=2.6e-46

Best Hits

Swiss-Prot: 42% identical to Y1031_BRUAB: Putative peptide transport system permease protein BruAb2_1031 (BruAb2_1031) from Brucella abortus biovar 1 (strain 9-941)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to psb:Psyr_2679)

MetaCyc: 37% identical to murein tripeptide ABC transporter / oligopeptide ABC transporter inner membrane subunit OppB (Escherichia coli K-12 substr. MG1655)
3.6.3.23-RXN [EC: 7.4.2.6]; 7.4.2.6 [EC: 7.4.2.6]

Predicted SEED Role

"Putative glutathione transporter, permease component" in subsystem Utilization of glutathione as a sulphur source

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZT04 at UniProt or InterPro

Protein Sequence (314 amino acids)

>Psyr_2679 Binding-protein-dependent transport systems inner membrane component (Pseudomonas syringae pv. syringae B728a ΔmexB)
MLMFILRRLLSSIPTLILVSLFVFTLQKLLPGDPVLAMAGEERDPAVMEYLRDKYRLDDP
IPLQYLNWVGNVLTGDLGTSLRTEQAVTTLLASKLPVTIELAVLALLIALLIGIPTGIIS
AVRKGTAVDYGANVVALSGISIPHFWLGILLIMVFAVKLQWLPASGFVPMGEDFGQNLKT
LILPAFVLGAGLSGILMRHTRSAMLEVLRTDYVRTARAKGLFPRTVILKHALRNALMPIV
TLTTLLFGELLGGAVLTEQVFSIPGFGKMIVDAVFNRDYAVVQGVVLCVAIGFLMLNLLA
DVLYRLINPRLRTA