Protein Info for Psyr_2677 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 PF00005: ABC_tran" amino acids 50 to 200 (151 residues), 116.2 bits, see alignment E=1.8e-37 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 250 to 337 (88 residues), 87.1 bits, see alignment E=3.3e-29 PF08352: oligo_HPY" amino acids 252 to 317 (66 residues), 71.1 bits, see alignment E=8.1e-24

Best Hits

Swiss-Prot: 53% identical to APPF_BACSU: Oligopeptide transport ATP-binding protein AppF (appF) from Bacillus subtilis (strain 168)

KEGG orthology group: K02032, peptide/nickel transport system ATP-binding protein (inferred from 100% identity to psb:Psyr_2677)

Predicted SEED Role

"Oligopeptide transport ATP-binding protein OppF (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZT06 at UniProt or InterPro

Protein Sequence (377 amino acids)

>Psyr_2677 Oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal (Pseudomonas syringae pv. syringae B728a ΔmexB)
MNLSERDIAGRPSPDSNVQKPILEGIGLSKHFAVESGLLQRKKPPVQAVNEVNLSVRKGE
TLALVGESGSGKSTLGRLLLNLLQPTAGDVIYEGRNLANLTPEKLRQVRRDLQIIFQDPF
ASLNPRMTVESIVGEPIWLHSQASRSDRQERVAELLRTVGLAPEHGGRHPHEFSGGQRQR
IGIARALASEPRLILGDEPVSALDVSVQAQVVNLLEDLKHQFGLTLVIVAHGLAVIRHMS
DRVAVMYLGEIVEQAPVDALFENPLHPYTQALMAAVPVSHPDLRQPRPLLGGDMPSPSRP
PSGCRFHTRCPHARALCKEAAPVMETVEAERQVACHFWREIANAGSATLILPTPSAAYTQ
RLNLFKHHQSLAVESQP