Protein Info for Psyr_2546 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: DMT superfamily multiple drug (quaternary ammonium compounds) efflux pump

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 119 signal peptide" amino acids 9 to 11 (3 residues), see Phobius details transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 37 to 60 (24 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details PF00893: Multi_Drug_Res" amino acids 13 to 104 (92 residues), 57.3 bits, see alignment E=9.1e-20

Best Hits

Swiss-Prot: 34% identical to YVAE_BACSU: Uncharacterized membrane protein YvaE (yvaE) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2546)

Predicted SEED Role

"Ethidium bromide-methyl viologen resistance protein EmrE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZTD7 at UniProt or InterPro

Protein Sequence (119 amino acids)

>Psyr_2546 DMT superfamily multiple drug (quaternary ammonium compounds) efflux pump (Pseudomonas syringae pv. syringae B728a ΔmexB)
MPEKRSAIMVIKAYLFLLAGIVAETVATIALKESNGFTRWVPVIASIAGYGLGIVCLGYA
QRDLPMSLITSMWSGLGITLITVIAAFRYQQVPTLMAIGGISLIIAGIILVNLAKEQAT