Protein Info for Psyr_2505 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: amino acid ABC transporter membrane protein 2, PAAT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 transmembrane" amino acids 22 to 50 (29 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 87 to 109 (23 residues), see Phobius details amino acids 159 to 179 (21 residues), see Phobius details amino acids 181 to 183 (3 residues), see Phobius details amino acids 189 to 209 (21 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 17 to 112 (96 residues), 76.7 bits, see alignment E=8.4e-26 PF00528: BPD_transp_1" amino acids 36 to 217 (182 residues), 81.2 bits, see alignment E=4.2e-27

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to psb:Psyr_2505)

Predicted SEED Role

"Amino acid ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZTH8 at UniProt or InterPro

Protein Sequence (220 amino acids)

>Psyr_2505 amino acid ABC transporter membrane protein 2, PAAT family (Pseudomonas syringae pv. syringae B728a ΔmexB)
MYQPPGWLQELWNAREVLWSGFLTSIQCSALAIAAGTLIGMLAGLVLTYGGFFARLPIRL
YVDLIRGTPVFVLVLAVFYMVPALGWQISAFQAGAIGLTLFCGSHVSEIVRGALQAIPRG
QLEAGKAIGLRFGQSLRYVLLPQAMRQILPTWVNSSTEIVKASTLLSVIGVAELLLSTQQ
VIARTFMTLEFYLFAGFLFFLINYAIELLGRQIEKRVALP