Protein Info for Psyr_2482 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Secretion protein HlyD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 signal peptide" amino acids 1 to 42 (42 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 72 to 397 (326 residues), 246.2 bits, see alignment E=2.2e-77 PF16576: HlyD_D23" amino acids 93 to 316 (224 residues), 39.4 bits, see alignment E=6.1e-14 PF13533: Biotin_lipoyl_2" amino acids 94 to 142 (49 residues), 56.7 bits, see alignment 2.4e-19 PF13437: HlyD_3" amino acids 205 to 306 (102 residues), 30.8 bits, see alignment E=6.3e-11

Best Hits

Swiss-Prot: 51% identical to MDTA_ENT38: Multidrug resistance protein MdtA (mdtA) from Enterobacter sp. (strain 638)

KEGG orthology group: K07799, putative multidrug efflux transporter MdtA (inferred from 100% identity to psb:Psyr_2482)

Predicted SEED Role

"RND transporter, membrane fusion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZTK1 at UniProt or InterPro

Protein Sequence (434 amino acids)

>Psyr_2482 Secretion protein HlyD (Pseudomonas syringae pv. syringae B728a ΔmexB)
MVDLFMQSSGSRKSRRWLISLLVLLVIVALCWWFWPASTSGKGAESNKKPATSGMARPGF
GGSAVAVPVRVAPATEGDFPIYYKALGTVTAMNTINVRSRVAGELVKLYFQEGQMVKAGD
LLAEIDPRSYQVALQQAEGTLATNQALLKNAQLDVQRYRGLFAEDSIAKQTLDTAESLVN
QYKGTIKTNQAAVADAKLNLDFSRIRAPIAGRVGLKQLDVGNLVAANDTTALAVITQTQP
ISVAFTLPEKDLSKVISRYRTGDKLPVEAWDRGDTKMQATGVLASLDNQIDVATGTLKFK
ARFDNSDEVLFPNQFVNIRLRADTLKKVTLVPTAAVQFGTDGTFVYVLDGDKKVKLKLLK
TGPSDETSTVITEGLAAGERVVLEGTDRLRDGAEVEVVNDSKEVPAGPAQKLQGKPDSKT
DKSAALGKVEKPNV