Protein Info for Psyr_2377 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Flavoprotein monooxygenase:Monooxygenase, FAD-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 553 PF01494: FAD_binding_3" amino acids 26 to 365 (340 residues), 291.8 bits, see alignment E=2.9e-90 PF00890: FAD_binding_2" amino acids 27 to 58 (32 residues), 22.2 bits, see alignment (E = 2.7e-08) PF01266: DAO" amino acids 27 to 64 (38 residues), 28.3 bits, see alignment 4.7e-10 PF13450: NAD_binding_8" amino acids 30 to 60 (31 residues), 26.2 bits, see alignment (E = 2.8e-09) PF21274: Rng_hyd_C" amino acids 414 to 519 (106 residues), 30.2 bits, see alignment E=1.6e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2377)

Predicted SEED Role

"FAD-binding monooxygenase, PheA/TfdB family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZTV6 at UniProt or InterPro

Protein Sequence (553 amino acids)

>Psyr_2377 Flavoprotein monooxygenase:Monooxygenase, FAD-binding protein (Pseudomonas syringae pv. syringae B728a ΔmexB)
MSDGDIHFQSNTFKLNTHQPVEQDVCDVLIIGSGPTGLALACDLARRGIKVRIIEKSAVP
FNGSRGKGIQPRTIEVFDNLGVAQPLLGVGQLYPPMKFHVSFLKIKWNMMKYQKQTADIP
YPNVWLVPQWRTEQVLRDRLAELGTQVEWDTGALQIKQDAEGVSVRVACQGEPRIVHARY
LVGADGGKSFVRKQLGVNFTGSTSQEGRMIVGDLHVEGLSRDAWHIWPTRKGGMIGLCPL
PHSSLFQLMMRLDADEPAPELSEHAIQTRWLAATGSRKIHLHSPTWLSVFRPNVRLAERY
RVERVFLAGDAAHVHTPAGAQGLNTGVQDAWNLGWKLAAVLDGAPEALLDTYEEERRPVA
AAVLELSSELFNNTTGTGLPTFRRGDKERQLLLNYRASSLSVNSADNVDGKVQAGDRAPD
ATCSQQHGGRTRLFDVFRGGHFTLLAFGTQAIAAMNTFGSRDERFLQAVAVRPAHLSNDR
YGLVDETGQARDAYGVSLQENIIFLIRPDGYVGLTATDDFVPAVQRYLATLSRTPDSLAG
SDADMQATRAVAH