Protein Info for Psyr_2300 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Conserved hypothetical protein 374

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 45 to 63 (19 residues), see Phobius details amino acids 129 to 146 (18 residues), see Phobius details amino acids 152 to 169 (18 residues), see Phobius details amino acids 208 to 232 (25 residues), see Phobius details amino acids 238 to 275 (38 residues), see Phobius details amino acids 285 to 309 (25 residues), see Phobius details PF03706: LPG_synthase_TM" amino acids 16 to 304 (289 residues), 156.6 bits, see alignment E=5.2e-50 TIGR00374: TIGR00374 family protein" amino acids 29 to 309 (281 residues), 102.9 bits, see alignment E=1.1e-33

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2300)

Predicted SEED Role

"Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZU29 at UniProt or InterPro

Protein Sequence (322 amino acids)

>Psyr_2300 Conserved hypothetical protein 374 (Pseudomonas syringae pv. syringae B728a ΔmexB)
MSGSLLLSGWRYRTVLLSIVVSAMGYLGFSLWGGWQAVSAATGKVGLLGISVALLMSAIN
YALRFVRWQLYLSVLGHPLAWRKSLRIYLAGFALTTTPGKAGEALRGVLLRPLGVPYPQS
FAAFVSERLSDLLAIVLLTLFGLSWYPQAQPMILLGLALVLTGSLVLSRRHLLERLQASL
PTKNTRVSSLWQQLFNVLLAARQCLHGNVLLTASLLSLLAWSAEALAFYWMLGWMGAQIP
LTFAVFTYALAMLAGALSFMPGGLGSAEAVMVGLLMFKGMPGADAVAATVLIRLATLWFA
VAIGAVMLSRFTGAKPVPNPQS