Protein Info for Psyr_2230 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Mn2+/Fe2+ transporter, NRAMP family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 transmembrane" amino acids 25 to 45 (21 residues), see Phobius details amino acids 55 to 75 (21 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 125 to 149 (25 residues), see Phobius details amino acids 161 to 180 (20 residues), see Phobius details amino acids 201 to 224 (24 residues), see Phobius details amino acids 246 to 267 (22 residues), see Phobius details amino acids 288 to 309 (22 residues), see Phobius details amino acids 344 to 362 (19 residues), see Phobius details amino acids 368 to 391 (24 residues), see Phobius details amino acids 408 to 428 (21 residues), see Phobius details PF01566: Nramp" amino acids 44 to 405 (362 residues), 151.4 bits, see alignment E=1.8e-48

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2230)

Predicted SEED Role

"Mn2+/Fe2+ transporter, NRAMP family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZU99 at UniProt or InterPro

Protein Sequence (433 amino acids)

>Psyr_2230 Mn2+/Fe2+ transporter, NRAMP family (Pseudomonas syringae pv. syringae B728a ΔmexB)
MPLTPSLKETATPVAEPRLKKFAKLLGPGIIAVLSWLGAGDLITSSVAGASYGYAMMWVL
AISLLLRFLIVNIIARFQLCNNQGMTILQGYAQLHPLFAWFMLGYALLMGHLINAYMIKG
AGEALAMLLHIDQPLLCSVAVVIAVWLLVGRNIYAMIEGVMKVLLAIMTLAFLTLAIMSG
PDVTGIIKGTIGFSIPPDEGVHGALLVAVSVIGAVAGSIANFVHPYVMREKGWTGPEHKR
IQRNDLLFAVIVGIVINLAIWVVGVEILRPNGIQVNTLADLGKALEIFFGPLGWYIFFIG
VFATLFASISGKTTAFPMLITDAFQHIQPKRRERYGKVFHNDPMHRWFMLFILVTPLIWS
LPGMPDFVTLTLGVNALNIIGLPVISLGLLIMSNQKSLLSKEYRNNWFENIALTFATGLA
LWVAFQLGTELLA