Protein Info for Psyr_2204 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: amino acid/amide ABC transporter membrane protein 1, HAAT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 44 to 63 (20 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 101 to 119 (19 residues), see Phobius details amino acids 152 to 171 (20 residues), see Phobius details amino acids 203 to 223 (21 residues), see Phobius details amino acids 236 to 258 (23 residues), see Phobius details amino acids 267 to 289 (23 residues), see Phobius details TIGR03409: urea ABC transporter, permease protein UrtB" amino acids 8 to 299 (292 residues), 390.7 bits, see alignment E=2.7e-121 PF02653: BPD_transp_2" amino acids 11 to 286 (276 residues), 136.9 bits, see alignment E=3.8e-44

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 100% identity to psb:Psyr_2204)

Predicted SEED Role

"Urea ABC transporter, permease protein UrtB" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZUC5 at UniProt or InterPro

Protein Sequence (300 amino acids)

>Psyr_2204 amino acid/amide ABC transporter membrane protein 1, HAAT family (Pseudomonas syringae pv. syringae B728a ΔmexB)
MTLDTLVMQVFSGFSLFSVLVLMALGLTIVFGLMGVINMAHGELMAMGSYMTYVTSVVFQ
RYFPELMDWYFIIGIGMAFVVTFAFGLLLERCFIRFMYNRPLDTLLATWGLSLVLQQLFR
QVFGPKEVSVPTVQWLQGAWKISDGLELPLNRIFIIGLTFVIAAAVFLFLYRSRWGLRIR
AVTQNRAMAGAAGINTARVDSVTFALGCGLAGIAGSSFTMLASTGPVSGQQYLVDTFIVV
VFGGVESLLGTFLSAFAIGQTQVSLEYLTTGSMAKAITLLVVIVLLFFRPNGLFATKVRR