Protein Info for Psyr_2195 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Urease accessory protein UreD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 PF01774: UreD" amino acids 57 to 262 (206 residues), 138.1 bits, see alignment E=2.2e-44

Best Hits

Swiss-Prot: 100% identical to URED1_PSEU2: Urease accessory protein UreD 1 (ureD1) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K03190, urease accessory protein (inferred from 100% identity to psb:Psyr_2195)

Predicted SEED Role

"Urease accessory protein UreD" in subsystem Urea decomposition

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZUD4 at UniProt or InterPro

Protein Sequence (285 amino acids)

>Psyr_2195 Urease accessory protein UreD (Pseudomonas syringae pv. syringae B728a ΔmexB)
MNAHQSSLPAQTKRTAHIAFSKAPSGASYVSRQEVGYPFHLGRTLTLPQDPPGMAAVYLQ
SCSGGLFAGEQLHLHLHAGPGTQVHVSTGAATVAHSMLEQSARQTVTLVAEADALLEYLP
MATILFPQTRLHSQVNVTLHPGARVLLCDAFCLHTPHGSEGLPDFYRADLQVYSPAGKLL
AGDRLAITGADLQRRLPGVSGQRQALATFMLVGQGLPIEDLKRTLRETLRDVADSYQGVS
ALPNDCGVSVRVMSADAVALRNALHLAWACVRQQLTGLAPRVRRK