Protein Info for Psyr_2193 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Secretion protein HlyD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 39 to 357 (319 residues), 186.2 bits, see alignment E=3.9e-59 PF16576: HlyD_D23" amino acids 62 to 261 (200 residues), 49.1 bits, see alignment E=8.9e-17 PF13533: Biotin_lipoyl_2" amino acids 66 to 108 (43 residues), 29.4 bits, see alignment 1.1e-10 PF13437: HlyD_3" amino acids 172 to 263 (92 residues), 41.2 bits, see alignment E=4.9e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2193)

Predicted SEED Role

"RND efflux membrane fusion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZUD6 at UniProt or InterPro

Protein Sequence (367 amino acids)

>Psyr_2193 Secretion protein HlyD (Pseudomonas syringae pv. syringae B728a ΔmexB)
MLLSRPNTTVLLLLPLFLAACSESSGVRDPRTQPPLVRAATVASADQASRSFTGVVVARV
QSELGFRVSGKVLERLVDTGQTVKRGEPLMRLDPVDLGLQAQAQQQAVAAAVARARQTAD
DEARNRDLVVAGAISASAYDRIKSLADTAKAELNAAQAQASVARNASGYAVLLADADGVV
VDTLVEPGQVVSAGQPVVRLAKAGPREAIVHLPETLRPAMGDRAEARLYGDSARVIPARL
RLLSDAADPLTRTFEARYVLEGSNVSAPLGSTVSLDIAAGKPARQSLAIPIAALHDPGRG
PGVWVIAGTPAQVTWRAVQLLGVSDDSANVSGGLEAGEQVVALGTHLLHDGEQVRVQQGG
ITAEAQP