Protein Info for Psyr_2146 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: methionine aminopeptidase, type I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 TIGR00500: methionine aminopeptidase, type I" amino acids 5 to 251 (247 residues), 307.7 bits, see alignment E=3e-96 PF00557: Peptidase_M24" amino acids 15 to 243 (229 residues), 182.7 bits, see alignment E=4e-58

Best Hits

Swiss-Prot: 58% identical to MAP1_ECOLI: Methionine aminopeptidase (map) from Escherichia coli (strain K12)

KEGG orthology group: K01265, methionyl aminopeptidase [EC: 3.4.11.18] (inferred from 100% identity to psb:Psyr_2146)

MetaCyc: 58% identical to methionine aminopeptidase (Escherichia coli K-12 substr. MG1655)
Methionyl aminopeptidase. [EC: 3.4.11.18]

Predicted SEED Role

"Methionine aminopeptidase (EC 3.4.11.18)" (EC 3.4.11.18)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.4.11.18

Use Curated BLAST to search for 3.4.11.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZUI3 at UniProt or InterPro

Protein Sequence (263 amino acids)

>Psyr_2146 methionine aminopeptidase, type I (Pseudomonas syringae pv. syringae B728a ΔmexB)
MSSAIGIKTEQDLVQLRIAGRLAADVLAMITPYVKAGVSTEALDDICNEYIVKELKVIPA
NVGYHGFTKTTCISPNAVVCHGIPSATDILKEGDIVNIDVAVIKDGWYGDTSRMYLVGEV
SPLARRLVETTYEATRAGIHAVRPGATLGDIGYAIQSVAHREGFSVVREYCGHGIGRKYH
EEPQVLHYGAQGKGLRLKPGMVFTIEPMINAGRAGTRTLPDGWTVLTSDLSLSAQWEHMV
AVTSTGFELLTPWPDGTGDYPAI